$(this).removeClass('active'); Bist du sicher, dass du fortfahren möchtest? "eventActions" : [ "selector" : "#kudosButtonV2_2", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ffJUvtzLOA_jRIx9GxpmWiNyGxRwgTXjGTvlFs63gZI. "parameters" : { }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); window.scrollTo(0,position_x.top - 150); "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName", { { ] { "disableLinks" : "false", "actions" : [ $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "initiatorDataMatcher" : "data-lia-kudos-id" } "action" : "pulsate" "actions" : [ "message" : "2218300", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ "action" : "pulsate" "actions" : [ ] } "disableLabelLinks" : "false", ] Das problem tritt dann immer im gesamten Haus auf. LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "initiatorBinding" : true, } "forceSearchRequestParameterForBlurbBuilder" : "false", ] "event" : "markAsSpamWithoutRedirect", }, } }); }, { $(document).ready(function(){ { "eventActions" : [ "selector" : "#kudosButtonV2_4", "action" : "rerender" LITHIUM.Loader.runJsAttached(); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '6R3Z-KiyAQ598dYJV1Um5-CI5fPSoHIfNnK-XJPCLpw. LITHIUM.AjaxSupport.ComponentEvents.set({ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "", { { "event" : "addMessageUserEmailSubscription", ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); } { } { "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "message" : "2114144", } "action" : "rerender" "useSimpleView" : "false", ] ;(function($) { ] "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" } "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", "context" : "", "event" : "editProductMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] { } { "event" : "deleteMessage", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { }, ;(function($) { } "context" : "envParam:quiltName", { ctaHTML += "Lösung noch nicht gefunden? "forceSearchRequestParameterForBlurbBuilder" : "false", }, // Set start to true only if the first key in the sequence is pressed "event" : "QuickReply", { "parameters" : { "actions" : [ "message" : "2114644", { "disallowZeroCount" : "false", "initiatorBinding" : true, "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "pulsate" "kudosLinksDisabled" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "selector" : "#kudosButtonV2_3", "disableLabelLinks" : "false", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114644,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); } "actions" : [ "event" : "ProductAnswer", Bist du sicher, dass du fortfahren möchtest? } "event" : "ProductAnswer", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); Instagram: Warum sind Nachrichten bei manchen blau? }, LITHIUM.Auth.CHECK_SESSION_TOKEN = '0X17wl1WTGX4FmVUWinWxxInP4ssZwLm1yIwVbSeYE4. } "disableKudosForAnonUser" : "false", "action" : "rerender" "actions" : [ ] } else { }); "forceSearchRequestParameterForBlurbBuilder" : "false", }, } "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { } ;(function($) { } "event" : "RevokeSolutionAction", $('#vodafone-community-header .lia-search-toggle').click(function() { "action" : "rerender" { "context" : "envParam:quiltName", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); "event" : "addMessageUserEmailSubscription", "useTruncatedSubject" : "true", "selector" : "#messageview_3", "event" : "deleteMessage", }, "selector" : "#kudosButtonV2_2", O2 bildet das Schlusslicht, wenn auch mit stattlichen 225 MBit. "messageViewOptions" : "1111110111111111111110111110100101001101" "disableKudosForAnonUser" : "false", "actions" : [ "action" : "rerender" }, "event" : "MessagesWidgetEditAction", ] } "useSimpleView" : "false", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'k8Dusp3hBmS9mQV00gN4UwnfwR3tHDipYN-s_I5SN_I. "initiatorBinding" : true, LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName,message", "event" : "editProductMessage", "actions" : [ ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "componentId" : "forums.widget.message-view", { "forceSearchRequestParameterForBlurbBuilder" : "false", }, { "event" : "kudoEntity", "disableKudosForAnonUser" : "false", Die Vodafone GmbH bietet als Tochter der britischen Vodafone Group Mobiltarife, DSL, LTE, Festnetz-Verträge und IPTV an. { "action" : "rerender" "context" : "", { "useTruncatedSubject" : "true", { + 5GB LTE Vodafone Allnet für 14,99€/Monat + 0,00€ AG – otelo Allnet-Flat Go 590 29.12.2020, 13:00 Uhr "action" : "pulsate" "event" : "ProductAnswerComment", { }); "kudosable" : "true", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ { "event" : "addThreadUserEmailSubscription", ] ] ] ], }, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", ], "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetEditAction", "action" : "addClassName" "context" : "", { "event" : "removeMessageUserEmailSubscription", "context" : "", LTE wird als Mobilfunktechnologie der 4. digitalen Generation auch mit 4G abgekürzt. ] '; "actions" : [ "buttonDialogCloseAlt" : "Schließen", { { { ] } "actions" : [ "action" : "rerender" } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] } "context" : "", "message" : "2218554", "event" : "removeMessageUserEmailSubscription", }, }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2114650 .lia-rating-control-passive', '#form_2'); Technologie. "context" : "", "disallowZeroCount" : "false", "context" : "", } "parameters" : { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", resetMenu(); "actions" : [ }, }, watching = true; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "includeRepliesModerationState" : "false", "context" : "", ] .attr('aria-hidden','false') { } "context" : "", ] { } "action" : "rerender" "context" : "", if ( neededkeys[count] == key ) { { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "revokeMode" : "true", } "useTruncatedSubject" : "true", }, "truncateBody" : "true", }, ', 'ajax'); "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", }, { { { "action" : "rerender" })(LITHIUM.jQuery); "action" : "pulsate" }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); } "action" : "rerender" ], LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.ComponentEvents.set({ "disableLinks" : "false", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "buttonDialogCloseAlt" : "Schließen", "event" : "MessagesWidgetMessageEdit", } }); "buttonDialogCloseAlt" : "Schließen", ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2114154 .lia-rating-control-passive', '#form_0'); "action" : "rerender" "action" : "rerender" "actions" : [ "action" : "pulsate" "}); "context" : "", "actions" : [ "context" : "", { Siyata Mobile Signs Vendor Agreement and Receives First PO From Leading Global Two-way Radio Vendor MONTREAL, QC --(Marketwired - June 08, 2017) - Siyata Mobile Inc. (the "Company" or "Siyata") (TSX VENTURE: SIM) (OTCQB: SYATF) is pleased to announce that it has signed a vendor agreement and receives a Purchase Order from a leading global two-way radio vendor. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ ] "truncateBody" : "true", ] "disableKudosForAnonUser" : "false", ] "actions" : [ ;(function($) { } // enable redirect to login page when "logmein" is typed into the void =) "context" : "", "action" : "rerender" { "event" : "approveMessage", }, { ] "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:feedbackData", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "disallowZeroCount" : "false", "action" : "rerender" } { { { ] { "actions" : [ "useSubjectIcons" : "true", LITHIUM.Auth.CHECK_SESSION_TOKEN = '0X17wl1WTGX4FmVUWinWxxInP4ssZwLm1yIwVbSeYE4. // Oops, not the right sequence, lets restart from the top. } "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "context" : "", "action" : "rerender" } if ( watching ) { Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditCommentForm", } }, "event" : "MessagesWidgetEditAction", ] }, }, ] "actions" : [ { { "truncateBody" : "true", ] }, { } var keycodes = { var keycodes = { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); watching = false; }, ;(function($) { { ] watching = false; "action" : "rerender" ;(function($) { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useSimpleView" : "false", { "eventActions" : [ "actions" : [ { "}); ;(function($) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "linkDisabled" : "false" }, { } "context" : "envParam:quiltName,message", $(document).ready(function(){ ] }, "action" : "rerender" "action" : "rerender" } ] ] "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114144,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "actions" : [ "actions" : [ } Grund hierfür ist das ich in einer neuen Wohnung wohne wo das Kabel Internet so schlecht ist das ich nichtmal 10mibt/s hinbekomme. ], "actions" : [ { LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); ] } }, Diese bekommen nur die Bandbreite die noch übrig ist. "action" : "rerender" "event" : "ProductMessageEdit", ] "context" : "", } "action" : "rerender" }); } }); }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "actions" : [ "initiatorBinding" : true, "event" : "MessagesWidgetEditAnswerForm", ] "actions" : [ // enable redirect to login page when "logmein" is typed into the void =) ] { LITHIUM.AjaxSupport.ComponentEvents.set({ } LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. if ( watching ) { "actions" : [ }); }, "event" : "ProductAnswerComment", Aber seit wenigen Tagen habe ich am Abend immer wieder einbrechendes Internet. element.children('ul').slideDown(); ] } { "action" : "rerender" } LITHIUM.AjaxSupport.ComponentEvents.set({ "truncateBodyRetainsHtml" : "false", "componentId" : "kudos.widget.button", "useSubjectIcons" : "true", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); { { }, "action" : "rerender" "useSimpleView" : "false", } }, ] ], "action" : "rerender" }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_69b82a8d7795d9_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "disableLabelLinks" : "false", "kudosLinksDisabled" : "false", "action" : "rerender" "disableLabelLinks" : "false", "context" : "", "context" : "envParam:selectedMessage", "truncateBodyRetainsHtml" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ { "context" : "", "disallowZeroCount" : "false", "context" : "", ', 'ajax'); }, "event" : "MessagesWidgetMessageEdit", "kudosable" : "true", "action" : "rerender" { { ] }, "context" : "envParam:quiltName,message", "parameters" : { ] { { "action" : "addClassName" } }, }, { "event" : "deleteMessage", var count = 0; LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "includeRepliesModerationState" : "false", { "displaySubject" : "true", { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "eventActions" : [ { ] Private Daten erfragen wir bei Bedarf. // Reset the conditions so that someone can do it all again. "event" : "AcceptSolutionAction", }, "event" : "MessagesWidgetCommentForm", $(document).ready(function(){ Wenn ich jetzt auf Telekom LTE (Homespot von Congstar) wechsle, ist das dann noch die selbe Antenne? "actions" : [ { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2218554,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); ] LITHIUM.AjaxSupport.useTickets = false; "initiatorBinding" : true, "triggerEvent" : "click", }, "context" : "", } "disableLinks" : "false", count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { }, '; "}); "action" : "rerender" }); ;(function($) { "action" : "rerender" ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "parameters" : { "actions" : [ "action" : "rerender" "linkDisabled" : "false" "event" : "deleteMessage", { } "action" : "pulsate" "context" : "lia-deleted-state", })(LITHIUM.jQuery); "context" : "envParam:quiltName,expandedQuiltName", Erfahrungs- und Testbericht zum Vodafone GigaCube (1. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, }, { window.location = "https://forum.vodafone.de/t5/St%C3%B6rungsmeldungen-Mobilfunk/4G-LTE-sehr-langsam/td-p/2114144" + "/page/" + 1; "context" : "", "actions" : [ "selector" : "#kudosButtonV2_4", "disallowZeroCount" : "false", { "useCountToKudo" : "false", "componentId" : "kudos.widget.button", }, "action" : "pulsate" { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); }, "actions" : [ { "context" : "", "event" : "kudoEntity", } "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ ] "kudosLinksDisabled" : "false", { "action" : "rerender" ;(function($) { } { "action" : "rerender" }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { Ich bezahle monatlich zwischen 45 und 50 Euro für gigacube Internet. ] }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { LITHIUM.Auth.CHECK_SESSION_TOKEN = '0X17wl1WTGX4FmVUWinWxxInP4ssZwLm1yIwVbSeYE4.

Bezirksregierung Düsseldorf Bonneshof, Unter Der Sonne Der Toskana Ganzer Film, Online-kurse Weiterbildung Kostenlos, Falschparker Zettel Schreiben, Eintracht Braunschweig Frauen Aufstieg, Hotel Bamberg Modern, Online-kurse Weiterbildung Kostenlos, Silberner Löffel Im Mund, Umgangssprachlich, Spaßhaft: Dummkopf, Apple-id Gelöscht Aber Noch Angemeldet, Neurologe Nürnberg Mögeldorf,