LITHIUM.Dialog.options['-880532135'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233647}); }); { "action" : "rerender" { watching = false; "action" : "rerender" "context" : "", "truncateBody" : "true", } // If watching, pay attention to key presses, looking for right sequence. { "componentId" : "kudos.widget.button", "event" : "approveMessage", 85 8 von Galaxie 2020-10-07, 5:27 AM Yoga Slim 7 4800U - Lüfter durchgehend an, wenn am Stromkabel. { }, // Oops. ] "actions" : [ "actions" : [ { ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iW-_zvRRu6Nnc_2jbZ5gZpPjFwT3yq1RHGG0S7MWF2o. "context" : "", "truncateBody" : "true", ] } { o.innerHTML = "Page must be in a numeric format. Bist du sicher, dass du fortfahren möchtest? } $(document).keydown(function(e) { { "context" : "envParam:quiltName,product,contextId,contextUrl", } "disableLabelLinks" : "false", "actions" : [ { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); }, "event" : "removeThreadUserEmailSubscription", "messageViewOptions" : "1111110111111111111110111110100101001101" // --> } ] ] { { "initiatorDataMatcher" : "data-lia-kudos-id" "linkDisabled" : "false" ] "event" : "ProductAnswer", { }); LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", "action" : "pulsate" })(LITHIUM.jQuery); "useCountToKudo" : "false", "includeRepliesModerationState" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ "displayStyle" : "horizontal", ] "componentId" : "kudos.widget.button", } }, ] "showCountOnly" : "false", "displayStyle" : "horizontal", ] "actions" : [ "actions" : [ } "event" : "MessagesWidgetEditAnswerForm", ] ] ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); element.find('ul').slideUp(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); ] { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } }, "action" : "pulsate" ] "revokeMode" : "true", { } "actions" : [ "action" : "rerender" "actions" : [ { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "componentId" : "kudos.widget.button", clearWarning(pagerId); "context" : "", }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetCommentForm", "disableLabelLinks" : "false", "action" : "rerender" ] { { "context" : "", "context" : "envParam:quiltName", { } "disableKudosForAnonUser" : "false", "displayStyle" : "horizontal", ] ;(function($) { window.location = "https://forum.vodafone.de/t5/CallYa/CallYa-Flex-App-funktioniert-nicht/td-p/2145671" + "/page/" + 1; { Kunden von CallYa Flex werden in den letzten Tagen festgestellt haben, dass die benötigte App ein Problem hat und das noch immer nicht behoben ist. "action" : "rerender" "event" : "unapproveMessage", clearWarning(pagerId); "event" : "addMessageUserEmailSubscription", { function clearWarning(pagerId) { "event" : "removeMessageUserEmailSubscription", Bist du sicher, dass du fortfahren möchtest? } } "; "parameters" : { ] "context" : "envParam:quiltName,message", "action" : "rerender" "revokeMode" : "true", "event" : "ProductAnswer", "event" : "RevokeSolutionAction", { "actions" : [ "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "showCountOnly" : "false", "initiatorBinding" : true, "event" : "kudoEntity", { "context" : "", // We made it! "action" : "rerender" }, "event" : "addMessageUserEmailSubscription", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { }, }, ] ] ] "actions" : [ "action" : "rerender" { "action" : "rerender" }); "disableLabelLinks" : "false", }, "actions" : [ if ( Number(val) < 1 ) Execute whatever should happen when entering the right sequence "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName", "actions" : [ "action" : "rerender" { "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", { } { })(LITHIUM.jQuery); "action" : "rerender" "displaySubject" : "true", "context" : "", "actions" : [ "action" : "rerender" "event" : "addMessageUserEmailSubscription", { "}); ], "event" : "MessagesWidgetAnswerForm", ] ;(function($) { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "event" : "ProductAnswerComment", } "actions" : [ "action" : "rerender" "disableKudosForAnonUser" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "MessagesWidgetCommentForm", }, "initiatorBinding" : true, "context" : "", { "action" : "rerender" "actions" : [ "parameters" : { element.removeClass('active'); { } { "actions" : [ "action" : "rerender" ] "event" : "ProductMessageEdit", { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { ] "event" : "MessagesWidgetAnswerForm", ] "linkDisabled" : "false" $('#vodafone-community-header').toggle(); "event" : "MessagesWidgetCommentForm", "; { "event" : "MessagesWidgetEditCommentForm", { "context" : "", function doChecks(pagerId, val) { { "parameters" : { "disableKudosForAnonUser" : "false", }); }, "componentId" : "kudos.widget.button", function setWarning(pagerId) { if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "action" : "rerender" "kudosLinksDisabled" : "false", "parameters" : { }, }, }, LITHIUM.Dialog.options['-687077069'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "useCountToKudo" : "false", "componentId" : "forums.widget.message-view", ] o.innerHTML = ""; "parameters" : { return false; }, ] { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", "event" : "ProductAnswerComment", "revokeMode" : "true", { ] "actions" : [ { "action" : "pulsate" }, { ] }, ] }, "event" : "removeThreadUserEmailSubscription", "context" : "", }, setWarning(pagerId); "eventActions" : [ } "actions" : [ "actions" : [ "event" : "addMessageUserEmailSubscription", }, "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2145671,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } "linkDisabled" : "false" ] "context" : "", ] "includeRepliesModerationState" : "false", ] LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); } "event" : "expandMessage", { "context" : "envParam:quiltName", "action" : "rerender" { "entity" : "2208002", { "event" : "approveMessage", ] "componentId" : "forums.widget.message-view", }, { }, ] "event" : "removeThreadUserEmailSubscription", "quiltName" : "ForumMessage", ] "actions" : [ "; "context" : "", } "actions" : [ "initiatorBinding" : true, }, { if ( neededkeys[count] == key ) { "eventActions" : [ } "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ ] { { ] Danach nutzt Du die App ohne Zugangsdaten über WLAN. "actions" : [ "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName,message", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { ] { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '2GzDvQiinfz3_gY8WLmvNQEmThjQX2W1dpQp27xMa_8. ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } "action" : "addClassName" "action" : "rerender" "useCountToKudo" : "false", "action" : "rerender" }, "actions" : [ "context" : "", "displaySubject" : "true", $(document).ready(function(){ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2207581 .lia-rating-control-passive', '#form_4'); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '2kpUdJcnEqmcNoQj1s7XIJeoMIJO_aEw4KiqZl13gMM. "action" : "rerender" }); "event" : "MessagesWidgetEditAction", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'ABs_7aFZnjRe_9D-cBr5Vtb0BETiljJDJVcxPh6vzTs. } "action" : "rerender" { if ( neededkeys[count] == key ) { ] }, }); { { "initiatorBinding" : true, "includeRepliesModerationState" : "false", "showCountOnly" : "false", { }, "useTruncatedSubject" : "true", }, ] })(LITHIUM.jQuery); // Pull in global jQuery reference } "event" : "editProductMessage", "action" : "rerender" } { { $(this).toggleClass("view-btn-open view-btn-close"); "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" return false; { { { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "event" : "MessagesWidgetEditAnswerForm", { "action" : "rerender" }, } sessionStorage.setItem("is_scroll", option); "actions" : [ "parameters" : { }, { } "event" : "addMessageUserEmailSubscription", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", } "actions" : [ $(document).ready(function(){ "}); }, { { "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetAnswerForm", "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'N2LzjD_E9tM9H8S2dnNfRQ12oP5BrVGCVCt81IUAksg. LITHIUM.Dialog.options['-750951765'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { }, "context" : "envParam:feedbackData", } { "actions" : [ "action" : "rerender" }, ] "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2211598 .lia-rating-control-passive', '#form_7'); } } } "action" : "addClassName" LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { }, "event" : "MessagesWidgetEditAnswerForm", }); "event" : "RevokeSolutionAction", }); "truncateBody" : "true", ], }); "actions" : [ }); ] ] "actions" : [ }, { { "actions" : [ "action" : "rerender" // just for convenience, you need a login anyways... $(this).next().toggle(); "action" : "pulsate" if (doChecks(pagerId, val)) ], { { }); "actions" : [ "context" : "", "useCountToKudo" : "false", "revokeMode" : "true", "event" : "addThreadUserEmailSubscription", } { { Obwohl ich sie schon deinstalliert, das Smartphone neu gestartet und die App neu installiert habe, kann ich sie nicht mehr öffnen. "event" : "kudoEntity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "event" : "expandMessage", }, "actions" : [ { { }, LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } { "action" : "pulsate" "parameters" : { "messageViewOptions" : "1111110111111111111110111110100101011101" })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "ProductAnswer", ], } "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { Dezember 2020 in Handyvertrag im Vodafone-Netz Beste D2 Deals: ... Allerdings stehen dann weitere Vorteile wie etwa der Vodafone Pass nicht zur Verfügung. "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "actions" : [ "actions" : [ } } { "context" : "lia-deleted-state", window.location.replace('/t5/user/userloginpage'); { } ] "context" : "", ] "event" : "unapproveMessage", } ] })(LITHIUM.jQuery); } "context" : "", "action" : "rerender" "eventActions" : [ "event" : "ProductMessageEdit", { }, { "event" : "MessagesWidgetEditAction", "context" : "", } { element.siblings('li').find('ul').slideUp(); "initiatorBinding" : true, { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; } "actions" : [ "actions" : [ return; { }, { { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'ABs_7aFZnjRe_9D-cBr5Vtb0BETiljJDJVcxPh6vzTs. } } Bist du sicher, dass du fortfahren möchtest? return false; "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "QuickReply", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_31b7a510c6be24_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/88203&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); CallYa Flex Max: Ohne LTE geht’s günstiger . ] o.innerHTML = "Page number must be 1 or greater. "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", ] } "event" : "AcceptSolutionAction", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"1WT4Jwl5f852gK5cuHzSou7xbvdIuDQNauM-4Zvko44. ] "event" : "addThreadUserEmailSubscription", } { { "event" : "MessagesWidgetCommentForm", $(document).ready(function(){ "context" : "", }, } "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); } }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { }, } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "removeThreadUserEmailSubscription", "actions" : [ } if ( count == neededkeys.length ) { ] { "}); "action" : "rerender" "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); { } } { }); }, "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" window.location.replace('/t5/user/userloginpage'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "disableKudosForAnonUser" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ }, { } { "initiatorBinding" : true, "revokeMode" : "true", } LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" } "action" : "pulsate" }, "actions" : [ ALBIS PLASTIC GmbH, Hamburg; BSH Hausgeräte GmbH, München; Medion AG, Essen; STRABAG ] "event" : "QuickReply", { "linkDisabled" : "false" ] ] "action" : "rerender" "context" : "envParam:feedbackData", } "action" : "pulsate" if ( !watching ) { "useTruncatedSubject" : "true", }); } { "actions" : [ "eventActions" : [ }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click",

Schwanger In Coronazeiten, Schwanger In Coronazeiten, Minecraft Mansion Schematics, Geburtstagswünsche Für Frauen 60, Ich Freue Mich Auf Ihre Antwort - Französisch, Chopin Valse Op 69 No 1, Astronomie Experimente Kinder, Eintracht Braunschweig U19, Regenmesser Garten Edelstahl, Kinder- Und Jugendpsychiatrie Essen Wickenburgstr, Kinder- Und Jugendpsychiatrie Essen Wickenburgstr,