} "context" : "", } { "action" : "rerender" "actions" : [ "action" : "rerender" "event" : "unapproveMessage", "actions" : [ "event" : "QuickReply", }); $(document).ready(function(){ "truncateBody" : "true", "}); ] "context" : "envParam:quiltName,expandedQuiltName", }, "kudosLinksDisabled" : "false", } } "context" : "", var notifCount = 0; { "action" : "rerender" }, }, "triggerEvent" : "click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "actions" : [ "}); }, "action" : "pulsate" }, "useSimpleView" : "false", ], "event" : "ProductAnswer", "action" : "rerender" "action" : "rerender" { "accessibility" : false, })(LITHIUM.jQuery); "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName,expandedQuiltName", { { ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "QuickReply", $(document).keydown(function(e) { "initiatorDataMatcher" : "data-lia-message-uid" "selector" : "#kudosButtonV2_3", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_69b82a8d7795d9","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }); } { "event" : "deleteMessage", ', 'ajax'); "action" : "rerender" "context" : "", "kudosable" : "true", { "event" : "editProductMessage", "eventActions" : [ { }, { "event" : "markAsSpamWithoutRedirect", { }, { } "action" : "rerender" "context" : "envParam:entity", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2218300 .lia-rating-control-passive', '#form_3'); "action" : "rerender" } "event" : "removeMessageUserEmailSubscription", window.location.replace('/t5/user/userloginpage'); window.scrollTo(0,position_x.top - 150); "action" : "rerender" "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ { "disableLinks" : "false", Liebes Telekom-Team, könnt ihr bitte unseren Anschluss überprüfen? Die verkaufen nicht umsonst immer mit dem Zusatz "bis zu XYZ MBit/s". Instagram: Warum sind Nachrichten bei manchen blau? Welchen Sinn macht der Vodafone Gigacube? // We made it! ] ] { element.removeClass('active'); "action" : "rerender" { { ;(function($) { } }, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ], LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } }; } // console.log('watching: ' + key); "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "event" : "QuickReply", "componentId" : "kudos.widget.button", }, }, "event" : "unapproveMessage", } Wer hat de Gigacube oder hat ihn nicht und kann mir trotzdem eine schlüssige Antwort darauf geben? "action" : "pulsate" } var do_scroll = sessionStorage.is_scroll; LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "event" : "AcceptSolutionAction", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_69b82a8d7795d9', 'enableAutoComplete', '#ajaxfeedback_69b82a8d7795d9_0', 'LITHIUM:ajaxError', {}, 'Pb7oMGjlcRF7c-5Fc5iUqgFtJLQQZjg89i4IzTpLbVc. { "triggerEvent" : "LITHIUM:triggerDialogEvent", } "actions" : [ ], { "action" : "rerender" "truncateBodyRetainsHtml" : "false", "disableLinks" : "false", Wenn Sie sich an öffentlichen Plätzen mit vielen Menschen und hohem Datenaufkommen befinden, ist das Netz möglicherweise überlastet. Vodafone bietet mit den GigaCube-Tarifen eine interessante Alternative zu den alten, örtlich beschränkten „LTE-Zuhause Angeboten“ aus dem eigenen Haus. "displayStyle" : "horizontal", "event" : "RevokeSolutionAction", "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "event" : "editProductMessage", "truncateBodyRetainsHtml" : "false", } LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); } "context" : "", "context" : "", ] "action" : "rerender" { { } "action" : "pulsate" } { } } "context" : "envParam:quiltName", "disableLinks" : "false", "action" : "addClassName" { { ] "action" : "rerender" ] Von 15 mbits. "event" : "RevokeSolutionAction", Die Antwort gibt der GigaCube … { createStorage("true"); } "event" : "removeMessageUserEmailSubscription", "truncateBody" : "true", "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "MessagesWidgetCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); { Hey Leute wie ist der Vodafone Gigacube von Download Upload und Ping ? } "action" : "rerender" "initiatorBinding" : true, "action" : "rerender" ] { { } "truncateBody" : "true", "action" : "rerender" "kudosable" : "true", "actions" : [ "action" : "rerender" }, "entity" : "2218554", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233622}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "action" : "rerender" ;(function($) { { { ] ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { }); "action" : "pulsate" ] } "actions" : [ } LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "messageViewOptions" : "1111110111111111111110111110100101001101" "disallowZeroCount" : "false", { { "eventActions" : [ }, } Könnten Sie sich vorstellen, mit einer ... Vodafone und A1 in Österreich sehen konnte. Execute whatever should happen when entering the right sequence ] } }, "componentId" : "kudos.widget.button", "action" : "rerender" } { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233622}); "actions" : [ "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wZZndhQA58SiPOxzFA9gzEUx6xIlbisuWsndeYGj5WE. { "event" : "approveMessage", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" } { { "event" : "RevokeSolutionAction", "event" : "addMessageUserEmailSubscription", "disallowZeroCount" : "false", ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "deleteMessage", } { } }, ] "useTruncatedSubject" : "true", if (element.hasClass('active')) { "event" : "MessagesWidgetEditCommentForm", "messageViewOptions" : "1111110111111111111110111110100101001101" { "context" : "", } if ( !watching ) { }, "context" : "envParam:entity", ] }, "action" : "rerender" LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "useTruncatedSubject" : "true", "action" : "rerender" Nun habe ich bei Vodafone eine Antenne gekauft und gemerkt, dass die LTE Antenne nur einen Anschluss hat. "event" : "AcceptSolutionAction", "action" : "rerender" "action" : "rerender" "action" : "pulsate" window.onclick = function(event) { "initiatorDataMatcher" : "data-lia-kudos-id" } ', 'ajax'); { LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } "action" : "pulsate" "disableLabelLinks" : "false", ] { Breitband Marburg-Biedenkopf. }, watching = true; }, // --> "event" : "ProductAnswer", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ // console.log('watching: ' + key); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" }, "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ }, }, watching = false; element.addClass('active'); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }, { ] "event" : "editProductMessage", "disallowZeroCount" : "false", "actions" : [ } }, LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); } "truncateBody" : "true", } "event" : "addThreadUserEmailSubscription", "event" : "RevokeSolutionAction", { }, "eventActions" : [ { "message" : "2218300", "useSimpleView" : "false", }, }, "actions" : [ ] { "action" : "rerender" LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-kudos-id" })(LITHIUM.jQuery); { ] "dialogKey" : "dialogKey" "event" : "editProductMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", Execute whatever should happen when entering the right sequence "useSubjectIcons" : "true", { { }, ] ] } ] "linkDisabled" : "false" "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2218554,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "action" : "rerender" watching = false; { // --> { } "actions" : [ } "actions" : [ { // We're good so far. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2218554,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } } { }, { }, { "defaultAriaLabel" : "", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_69b82a8d7795d9_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "useTruncatedSubject" : "true", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "truncateBodyRetainsHtml" : "false", { { }, }); } "actions" : [ // Set start to true only if the first key in the sequence is pressed "event" : "MessagesWidgetCommentForm", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" ] { LITHIUM.Dialog({ ] }, "event" : "removeMessageUserEmailSubscription", }, "event" : "QuickReply", "includeRepliesModerationState" : "false", } "action" : "rerender" "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", } "event" : "editProductMessage", } "context" : "", { "action" : "rerender" { // enable redirect to login page when "logmein" is typed into the void =) { { count++; ] }, } "context" : "envParam:entity", "action" : "pulsate" }, { "selector" : "#messageview_4", "displayStyle" : "horizontal", "actions" : [ })(LITHIUM.jQuery); "initiatorDataMatcher" : "data-lia-kudos-id" { element.find('ul').slideUp(); "actions" : [ { { { { "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "action" : "rerender" "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" { "}); .attr('aria-selected','true'); }, "action" : "pulsate" } "useSubjectIcons" : "true", "action" : "rerender" } "event" : "addMessageUserEmailSubscription", }, $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "triggerEvent" : "click", }, "context" : "envParam:quiltName", }, }, "quiltName" : "ForumMessage", }, { }, "event" : "AcceptSolutionAction", }, ] }, "event" : "editProductMessage", })(LITHIUM.jQuery); { Der Ping liegt bei durchschnittlich 54. }, "quiltName" : "ForumMessage", "action" : "rerender" "action" : "rerender" }, LITHIUM.Dialog.options['-2076738239'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } }); { "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114144}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114154}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114644}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114650}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2218300}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2218554}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512251}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516950}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516709}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516120}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514889}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519908}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519900}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519836}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519757}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519254}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519019}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518762}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518483}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518219}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518157}}]); { "actions" : [ "action" : "rerender" LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "eventActions" : [ }, "event" : "unapproveMessage", "action" : "rerender" { ] "componentId" : "kudos.widget.button", "actions" : [ "actions" : [ lithadmin: [] { } "useSubjectIcons" : "true", // console.log(key); "actions" : [ { { "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ "context" : "", }, "event" : "unapproveMessage", { "actions" : [ }, ] var handleClose = function(event) { { } "context" : "", $(event.data.selector).addClass('cssmenu-open') resetMenu(); "event" : "MessagesWidgetMessageEdit", "actions" : [ { "action" : "rerender" ] "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" { resetMenu(); "selector" : "#messageview", $(event.data.selector).removeClass('cssmenu-open'); "displaySubject" : "true", { ] }, ] ] }, }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "parameters" : { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", "action" : "rerender" '; { { "message" : "2218554", "kudosable" : "true", } "event" : "editProductMessage", "action" : "rerender" { { }, "context" : "", Mehr Details können sie dem 188 Seiten starkem PDF-Dokument des Breitbandmessung Jahresbericht 2015 / 2016 entnehmen. { "context" : "", ', 'ajax'); "quiltName" : "ForumMessage", "actions" : [ watching = true; { } "disableLinks" : "false",