"event" : "MessagesWidgetEditAnswerForm", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ', 'ajax'); } else { "context" : "", }, { "event" : "removeThreadUserEmailSubscription", "event" : "RevokeSolutionAction", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_69b82a8d7795d9","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "actions" : [ "truncateBodyRetainsHtml" : "false", } { ;(function($) { "context" : "", "event" : "addMessageUserEmailSubscription", "actions" : [ "context" : "envParam:quiltName", "eventActions" : [ "action" : "pulsate" "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetEditAction", $(document).ready(function(){ "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName,message", "truncateBody" : "true", ], }, "kudosLinksDisabled" : "false", ;(function($) { { "actions" : [ { } "context" : "", "action" : "rerender" "disableLinks" : "false", ] Ich wohne ziemlich ländlich, eine DSL-Alternative gibt es nicht. "action" : "rerender" "useTruncatedSubject" : "true", var do_scroll = sessionStorage.is_scroll; }); }, Deshalb hab ich Intertnet durch LTE bekommen, aus der Steckdose per Gigacube. "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" "action" : "rerender" element.addClass('active'); ;(function($) { ] "actions" : [ "context" : "envParam:quiltName,message", "context" : "", var resetMenu = function() { "useTruncatedSubject" : "true", "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114650,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "event" : "expandMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2218554,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "deleteMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'y-RbIj7rgy__iRc3OErynjp05FkzZBtENGTG5bHCN3I. }, }, // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" "actions" : [ "context" : "envParam:quiltName", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114650,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], "quiltName" : "ForumMessage", $(document).ready(function(){ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "componentId" : "kudos.widget.button", "event" : "editProductMessage", "context" : "envParam:quiltName", return; "action" : "rerender" "context" : "envParam:selectedMessage", ] "useSimpleView" : "false", } { "componentId" : "forums.widget.message-view", $('#vodafone-community-header').toggle(); 3: 03.06.2020: Funkstrahlung LTE Router -welche Materialen absorbieren es? "context" : "", "action" : "rerender" ] "disableLabelLinks" : "false", } { } "entity" : "2218554", "event" : "removeThreadUserEmailSubscription", } } "context" : "", "selector" : "#kudosButtonV2_4", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", LITHIUM.Dialog.options['812675821'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" //$('#lia-body').removeClass('lia-window-scroll'); Handy: Samsung Galaxy A3 (2017) mit "context" : "envParam:quiltName", "context" : "envParam:entity", '; createStorage("false"); // We're good so far. "parameters" : { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "parameters" : { }, "actions" : [ "showCountOnly" : "false", { "actions" : [ { }, "actions" : [ // Reset the conditions so that someone can do it all again. "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" } { "event" : "ProductMessageEdit", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2218554 .lia-rating-control-passive', '#form_4'); })(LITHIUM.jQuery); "initiatorBinding" : true, } } { } { } "kudosable" : "true", ], "action" : "pulsate" "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" ] }); LITHIUM.AjaxSupport.ComponentEvents.set({ { "displayStyle" : "horizontal", "linkDisabled" : "false" "displaySubject" : "true", "action" : "rerender" "action" : "rerender" "useCountToKudo" : "false", "action" : "pulsate" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { "actions" : [ "action" : "rerender" } "event" : "MessagesWidgetEditAnswerForm", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '2NBBnuFCw2B4A1kyj7PLPekCLFmQwDtaOd2OiXzgn88. Upload bei 5 bis 6. // Oops. "event" : "editProductMessage", "context" : "", } "initiatorDataMatcher" : "data-lia-kudos-id" { { LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); { Vodafone wirbt aktuell mit bis zu 375 MBit im LTE-Netz (partiell sogar 500 MBit), die Telekom schickt ihre LTE-Kunden mit maximal 300 MBit auf die Datenautobahn. { ] { "action" : "rerender" ] } }, { "actions" : [ ] LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", "event" : "addThreadUserEmailSubscription", "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2114650 .lia-rating-control-passive', '#form_2'); { // enable redirect to login page when "logmein" is typed into the void =) "actions" : [ "actions" : [ { "context" : "", { })(LITHIUM.jQuery); "messageViewOptions" : "1111110111111111111110111110100101001101" } } ] } "event" : "expandMessage", "parameters" : { { "context" : "", { "actions" : [ "action" : "rerender" }); }, }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "action" : "rerender" Du kannst damit sehr große Dateien, z. } { "event" : "MessagesWidgetMessageEdit", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'k8Dusp3hBmS9mQV00gN4UwnfwR3tHDipYN-s_I5SN_I. }, "actions" : [ ;(function($) { }, { { "action" : "pulsate" "actions" : [ { "event" : "removeThreadUserEmailSubscription", "kudosLinksDisabled" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" LITHIUM.Dialog.options['450465907'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'g6TTcJw_Fk4vDTpkkxGqXOJmuEECFgbplj8mLFO2g5c. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Grund hierfür ist das ich in einer neuen Wohnung wohne wo das Kabel Internet so schlecht ist das ich nichtmal 10mibt/s hinbekomme. { }, ] "actions" : [ "action" : "rerender" }, { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); }, { }, }, "action" : "rerender" "context" : "", } "componentId" : "kudos.widget.button", "actions" : [ $('.css-menu').removeClass('cssmenu-open') ] "kudosLinksDisabled" : "false", } "initiatorDataMatcher" : "data-lia-kudos-id" { "event" : "MessagesWidgetEditCommentForm", "displaySubject" : "true", "truncateBodyRetainsHtml" : "false", { ], "actions" : [ }, "revokeMode" : "true", { }, }, "context" : "envParam:feedbackData", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "context" : "", ] "showCountOnly" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", } { "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "useTruncatedSubject" : "true", } }, } { gutefrage ist so vielseitig wie keine andere. Execute whatever should happen when entering the right sequence "actions" : [ }, ] "event" : "deleteMessage", "event" : "addMessageUserEmailSubscription", } } { ], "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,expandedQuiltName", "event" : "kudoEntity", "actions" : [ ] { }, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114144}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114154}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114644}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114650}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2218300}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2218554}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512251}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516950}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516709}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516120}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514889}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519908}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519900}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519836}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519757}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519254}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519019}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518762}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518483}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518219}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518157}}]); "event" : "MessagesWidgetAnswerForm", { "action" : "rerender" }; { "event" : "removeMessageUserEmailSubscription", Das gilt etwa für Fußballstadien oder belebte, öffentliche Plätze. }, ', 'ajax'); "event" : "MessagesWidgetEditCommentForm", "parameters" : { Was kannst Du tun? LITHIUM.AjaxSupport.ComponentEvents.set({ }, }); { }, "action" : "rerender" "action" : "rerender" "action" : "rerender" { { "eventActions" : [ "context" : "", "event" : "ProductAnswer", "event" : "addMessageUserEmailSubscription", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ffJUvtzLOA_jRIx9GxpmWiNyGxRwgTXjGTvlFs63gZI. //$('#community-menu-toggle').removeClass('active') }); "actions" : [ ] "linkDisabled" : "false" "selector" : "#messageview_1", "action" : "rerender" "}); "context" : "envParam:quiltName", ] }, ] } } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ ] In den Internetvertrag von meinen Kumpel habe ich eine sehr schnalle Verbindung von 30 Mbit... Bei mir ist 16 MBits DSL + 16 MBits LTE. "selector" : "#kudosButtonV2", "context" : "envParam:selectedMessage", ] ] habe ich dann eine Art andere Bandbreite und mit Glück mehr HighSpeed? ] } "context" : "envParam:quiltName", ] "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", element.siblings('li').removeClass('active'); "initiatorBinding" : true, }, "action" : "rerender" Guten Tag zusammen, ich habe seit einiger Zeit das Problem das mein 4G LTE sehr langsam ist. "action" : "rerender" "dialogKey" : "dialogKey" "action" : "rerender" "context" : "", "entity" : "2218300", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", welche Möglichkeit ist günstig und empfehlenswert? "context" : "envParam:entity", ] { "actions" : [ "includeRepliesModerationState" : "false", } { "context" : "lia-deleted-state", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); { { ] "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "action" : "rerender" "event" : "ProductMessageEdit", ] ] "actions" : [ "}); { ] "triggerEvent" : "click", }, "event" : "RevokeSolutionAction", { "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", LITHIUM.Auth.CHECK_SESSION_TOKEN = '0X17wl1WTGX4FmVUWinWxxInP4ssZwLm1yIwVbSeYE4. "event" : "approveMessage", "context" : "", { }, } "actions" : [ { "context" : "envParam:entity", ] } } ', 'ajax'); { Und seit etwa 4-5 Monaten ist das Internet extrem schlecht! } ;(function($) { ], Das LTE Netz ist hier allerdings sehr gut ausgebaut. { "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, Vielleicht könntest Du mal eine genauere Adressangabe liefern, dann können wir uns die Stationen anschauen, die für Deine LTE-Versorgung zuständig sind. ] }, } { } "showCountOnly" : "false", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ffJUvtzLOA_jRIx9GxpmWiNyGxRwgTXjGTvlFs63gZI. }, "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); if ( watching ) { "event" : "AcceptSolutionAction", "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "disableLabelLinks" : "false", lithstudio: [], "displaySubject" : "true", else { "displaySubject" : "true", Ist das ein Problem was vom Provider ausgeht oder kann ich irgendwas selber dagegen tun? { "}); "action" : "rerender" ] watching = false; "disableLabelLinks" : "false", "actions" : [ "actions" : [ "event" : "removeThreadUserEmailSubscription", "actions" : [ "context" : "", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" ] }, "event" : "removeThreadUserEmailSubscription", "event" : "approveMessage", "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2114644 .lia-rating-control-passive', '#form_1'); "action" : "rerender" { ] "event" : "MessagesWidgetCommentForm", "actions" : [ }, { ] { Bist du sicher, dass du fortfahren möchtest? if ( !watching ) { "initiatorBinding" : true, "event" : "ProductAnswerComment", }); }, "context" : "", "event" : "addMessageUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } "eventActions" : [ "actions" : [ "action" : "pulsate" $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { { { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { { "action" : "rerender" { ] ] }, "action" : "rerender" "context" : "", "parameters" : { "event" : "unapproveMessage", "action" : "rerender" ;(function($) { ] // console.log('watching: ' + key); { { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { "context" : "", ] { } { "triggerEvent" : "click", { // console.log('watching: ' + key); ;(function($) { $('#vodafone-community-header .lia-search-toggle').click(function() { ] "context" : "", ] "event" : "ProductMessageEdit", "action" : "rerender" } "action" : "pulsate" } }, ] Laut Presseberichten nehmen über 3 Millionen Kunden das DSL-Angebot von Vodafone … "context" : "", { "action" : "rerender" // We're good so far. "event" : "AcceptSolutionAction", "forceSearchRequestParameterForBlurbBuilder" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "MessagesWidgetEditAnswerForm", { "disableKudosForAnonUser" : "false", "disableLabelLinks" : "false", ] "event" : "MessagesWidgetEditAction", } "event" : "MessagesWidgetEditAnswerForm", }, "actions" : [ ] "event" : "AcceptSolutionAction", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73295","ajaxErrorEventName":"LITHIUM:ajaxError","token":"a62TrqMMXMHdpeTUwVLhX7WNP_5Xe9yL1sSclh3qQ2Q. "context" : "", ;(function($) { }, "event" : "deleteMessage", "triggerEvent" : "click", "context" : "envParam:quiltName,product,contextId,contextUrl", { ] } "disableKudosForAnonUser" : "false", "action" : "rerender" "kudosable" : "true", }, "event" : "AcceptSolutionAction", { ], "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "kudosable" : "true", ] "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetMessageEdit", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2218554 .lia-rating-control-passive', '#form_4'); "event" : "RevokeSolutionAction", "displayStyle" : "horizontal", "closeEvent" : "LITHIUM:lightboxCloseEvent", "initiatorBinding" : true, "disableLinks" : "false", }, ] { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } }); } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "actions" : [ }, ] "action" : "rerender" Vodafone GigaCube Empfang verbessern mit 2x LTE Fensterantennen? { "defaultAriaLabel" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "event" : "AcceptSolutionAction", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); } "actions" : [ "action" : "rerender" "actions" : [ { var key = e.keyCode; }, ] LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] überlastete 4G Stationen. Hallo, in meiner Gegend ist kein gutes Internet möglich. LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'y-RbIj7rgy__iRc3OErynjp05FkzZBtENGTG5bHCN3I. "context" : "", element.find('ul').slideUp(); { LITHIUM.AjaxSupport.useTickets = false; }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); } } "actions" : [ }, }, Warum ist mein LTE Giga cube sooooo langsam in 33449 ? { count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "action" : "addClassName" "actions" : [ } "context" : "envParam:selectedMessage", ] "action" : "rerender" "actions" : [ "displaySubject" : "true",