"actions" : [ { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1804158,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] ] "actions" : [ ] { "action" : "rerender" { LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_31b7ad0dda7b1f","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "event" : "ProductAnswerComment", ', 'ajax'); var do_scroll = sessionStorage.is_scroll; } "event" : "ProductAnswer", { "event" : "kudoEntity", { //$('#community-menu-toggle').removeClass('active') ] { "showCountOnly" : "false", "kudosable" : "true", "actions" : [ "revokeMode" : "true", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); ] } // If watching, pay attention to key presses, looking for right sequence. { var key = e.keyCode; } { "}); } "event" : "MessagesWidgetCommentForm", { { // Oops, not the right sequence, lets restart from the top. Könnte es sein, dass der Berater die 55 € alleine auf den Handyvertrag bezog und du dachtest, es sei die Gesamtsumme incl. } Danke im voraus ! }); } } ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "disableLinks" : "false", "action" : "rerender" "actions" : [ "action" : "rerender" "event" : "addMessageUserEmailSubscription", { { if ( neededkeys[count] == key ) { "actions" : [ "context" : "", "event" : "approveMessage", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" { { "closeEvent" : "LITHIUM:lightboxCloseEvent", } ] LITHIUM.AjaxSupport.useTickets = false; "event" : "unapproveMessage", "actions" : [ }, ] "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "disableLabelLinks" : "false", // enable redirect to login page when "logmein" is typed into the void =) } "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"__qwfcNObk9R7Id0W8VYK0wEEV3QSgrTGvoqJ5WCYc0. "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1889114,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "action" : "rerender" ;(function($) { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); element.removeClass('active'); "kudosable" : "true", "actions" : [ } $(document).keydown(function(e) { }, var handleClose = function(event) { "actions" : [ "includeRepliesModerationState" : "false", { { { "action" : "rerender" "action" : "rerender" "event" : "approveMessage", }, } LITHIUM.Loader.runJsAttached(); LITHIUM.Loader.runJsAttached(); { { "actions" : [ "event" : "MessagesWidgetMessageEdit", var watching = false; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"__qwfcNObk9R7Id0W8VYK0wEEV3QSgrTGvoqJ5WCYc0. "action" : "pulsate" }, { "actions" : [ } "actions" : [ "action" : "rerender" { Dort finden sich zahlreiche Hinweise zum Vorgehen gegen zu hohe Rechnungen im Bereich Gas und Strom. "accessibility" : false, if ( count == neededkeys.length ) { "context" : "", "context" : "envParam:quiltName", German. } "context" : "envParam:quiltName", "componentId" : "kudos.widget.button", "action" : "rerender" "initiatorBinding" : true, notifCount = parseInt($(this).html()) + notifCount; { { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "disableKudosForAnonUser" : "false", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", "action" : "rerender" .attr('aria-hidden','true') }, "parameters" : { $(document).keydown(function(e) { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", { "}); }, "event" : "QuickReply", { }, "event" : "addMessageUserEmailSubscription", { "useSubjectIcons" : "true", { "action" : "rerender" }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "unapproveMessage", }, "context" : "", "selector" : "#messageview_2", }, "event" : "deleteMessage", "kudosable" : "true", "context" : "envParam:quiltName,expandedQuiltName", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { } }); { "initiatorBinding" : true, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { ] "event" : "MessagesWidgetAnswerForm", { } { // Reset the conditions so that someone can do it all again. "initiatorBinding" : true, }, ] "event" : "ProductMessageEdit", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); // Oops. { }); "}); "action" : "rerender" }, } ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] }, }, { } "event" : "ProductAnswer", "action" : "rerender" }); { }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "pulsate" { "selector" : "#kudosButtonV2_0", }, "truncateBody" : "true", "action" : "rerender" }, "actions" : [ "selector" : "#messageview_3", } "actions" : [ "actions" : [ "actions" : [ ] "activecastFullscreen" : false, $(document).ready(function(){ }, }, { "triggerEvent" : "click", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1889020,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "showCountOnly" : "false", "event" : "ProductAnswer", { { } }, "actions" : [ }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { } { } }, ] } if ( !watching ) { } "event" : "MessagesWidgetEditAnswerForm", { "initiatorDataMatcher" : "data-lia-kudos-id" } } ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_31b7ad0dda7b1f","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "useTruncatedSubject" : "true", if ( !watching ) { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "pulsate" "event" : "editProductMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" ] "actions" : [ return; { LITHIUM.Dialog({ "actions" : [ "actions" : [ "eventActions" : [ }, Anstelle von 9,99€ zahle ich monatlich zwischen 63,34€ und 13,79€. "initiatorBinding" : true, } "action" : "addClassName" "event" : "RevokeSolutionAction", ] { }, "truncateBody" : "true", { "defaultAriaLabel" : "", .attr('aria-expanded','true'); "kudosable" : "true", } "action" : "addClassName" "actions" : [ "displaySubject" : "true", } //$('#vodafone-community-header').css('display','block'); "actions" : [ }, } }, "showCountOnly" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", { "actions" : [ } { ] }); "actions" : [ } }, }, "event" : "QuickReply", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'cbkZUBi4TGhpSMc4jUEjHA80TE9RxK-0vXC06hoptJM. "action" : "rerender" ] "actions" : [ { "showCountOnly" : "false", { "context" : "envParam:quiltName,message", { ] "action" : "rerender" ] watching = false; }, "action" : "rerender" } "context" : "", }else{ } "actions" : [ "action" : "rerender" "selector" : "#messageview", LITHIUM.Loader.runJsAttached(); "actions" : [ "event" : "editProductMessage", } ] $('#vodafone-community-header .lia-search-toggle').click(function() { { }); // console.log('watching: ' + key); "useSimpleView" : "false", "}); "actions" : [ "event" : "MessagesWidgetCommentForm", { "context" : "envParam:quiltName,expandedQuiltName", "eventActions" : [ ] { "actions" : [ { }, }, }, "action" : "rerender" "useSimpleView" : "false", }, "event" : "removeThreadUserEmailSubscription", var keycodes = { "action" : "rerender" "kudosLinksDisabled" : "false", "event" : "ProductAnswerComment", "actions" : [ "includeRepliesModerationState" : "false", }, "useSimpleView" : "false", { }); Bist du sicher, dass du fortfahren möchtest? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "event" : "kudoEntity", "linkDisabled" : "false" } "parameters" : { { }, ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { // just for convenience, you need a login anyways... { "context" : "", }); "actions" : [ })(LITHIUM.jQuery); "revokeMode" : "true", "context" : "", "actions" : [ "action" : "rerender" "action" : "rerender" } { "event" : "unapproveMessage", "actions" : [ { { ] "disallowZeroCount" : "false", "accessibility" : false, } "initiatorDataMatcher" : "data-lia-kudos-id" "parameters" : { ;(function($) { "actions" : [ { "actions" : [ ], } // --> "actions" : [ { { Ich kann hier auch nur das bestätigen, was unsere SuperUser schon geschrieben haben: Bei Vertragsabschluss/- verlängerung im Shop versuche bitte zunächst darüber eine Klärung. "action" : "rerender" } // If watching, pay attention to key presses, looking for right sequence. { "activecastFullscreen" : false, "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); Die Geschichte wiederholt sich. "actions" : [ { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "includeRepliesModerationState" : "false", "action" : "rerender" ] ] "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); } { "initiatorBinding" : true, LITHIUM.AjaxSupport.ComponentEvents.set({ }, } } "actions" : [ "; "actions" : [ { "initiatorDataMatcher" : "data-lia-message-uid" }, }, "context" : "envParam:quiltName,product,contextId,contextUrl", } LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "action" : "rerender" } $(this).addClass('active') { var watching = false; "componentId" : "forums.widget.message-view", "event" : "AcceptSolutionAction", "actions" : [ }, "useSubjectIcons" : "true", })(LITHIUM.jQuery); // Pull in global jQuery reference "componentId" : "kudos.widget.button", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() } if ( neededkeys[count] == key ) { "disableKudosForAnonUser" : "false", "event" : "addThreadUserEmailSubscription", } LITHIUM.Dialog({ "event" : "addThreadUserEmailSubscription", { "context" : "", } { }); ;(function($) { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "actions" : [ }, "actions" : [ "}); "actions" : [ "truncateBodyRetainsHtml" : "false", "context" : "", { "event" : "QuickReply", }); "actions" : [ { { { } "actions" : [ "showCountOnly" : "false", window.location.replace('/t5/user/userloginpage'); "displaySubject" : "true", "context" : "", "actions" : [ ] "action" : "rerender" }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1889585 .lia-rating-control-passive', '#form_4'); "actions" : [ { "actions" : [ })(LITHIUM.jQuery); "action" : "rerender" "displaySubject" : "true", "actions" : [ "action" : "rerender" { "revokeMode" : "true", "actions" : [ "event" : "expandMessage", { }, "actions" : [ "action" : "rerender" { } "displayStyle" : "horizontal", } { } })(LITHIUM.jQuery); // Pull in global jQuery reference $('div[class*="-menu-btn"]').removeClass('active'); window.location.replace('/t5/user/userloginpage'); "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); } "parameters" : { "context" : "envParam:quiltName", { } "revokeMode" : "true", { "actions" : [ "action" : "pulsate" "context" : "", "event" : "MessagesWidgetAnswerForm", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "selector" : "#kudosButtonV2_4", "actions" : [ "event" : "ProductAnswerComment", lithadmin: [] "eventActions" : [ "event" : "ProductAnswerComment", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_17c878f5cafef8","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/225454&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "expandMessage", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ;(function($) { "action" : "rerender" ] Die Kontaktseite von Unitymedia, in der Sie auch die Hotline finden (0221 / 4661 9098), ist bereits mit einem Vodafone-Logo versehen- "actions" : [ "event" : "MessagesWidgetAnswerForm", "triggerEvent" : "click", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); Hallo @Max1233 , danke das du dich hier in der Community gemeldet hast. "context" : "", "action" : "rerender" "useCountToKudo" : "false", "useSubjectIcons" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { }, "event" : "kudoEntity", "revokeMode" : "true", if (element.hasClass('active')) { ] { }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, "truncateBody" : "true", "showCountOnly" : "false", }, "event" : "editProductMessage", ', 'ajax'); "actions" : [ ], }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wIAXVAbi8uU0tKT1hp0xyF1iPI60cBuvwykfr5n36o4.